| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
| Protein Lactate dehydrogenase [56339] (18 species) |
| Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [56343] (13 PDB entries) |
| Domain d4b7uc2: 4b7u C:165-330 [219361] Other proteins in same PDB: d4b7ua1, d4b7ub1, d4b7uc1, d4b7ud1 automated match to d1t2da2 complexed with bcn, ca, edo, mpd |
PDB Entry: 4b7u (more details), 1.88 Å
SCOPe Domain Sequences for d4b7uc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b7uc2 d.162.1.1 (C:165-330) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
gvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklisd
aeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqyghs
difggtpvvlgangveqvielqlnseekakfdeaiaetkrmkalah
Timeline for d4b7uc2: