SCOPe 2.04: Domain d4b7uc2: 4b7u C:165-330

Lineage for d4b7uc2 (4b7u C:165-330)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (19 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [56343] (13 PDB entries)

8. Domain d4b7uc2: 4b7u C:165-330 [219361]
   Other proteins in same PDB: d4b7ua1, d4b7ub1, d4b7uc1, d4b7ud1
   automated match to d1t2da2
   complexed with bcn, ca, edo, mpd

Details for d4b7uc2

PDB Entry: 4b7u, 1.88 Å

PDB Description: plasmodium falciparum l-lactate dehydrogenase complexed with bicine

PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d4b7uc2:

Sequence; same for both SEQRES and ATOM records:

>d4b7uc2 d.162.1.1 (C:165-330) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
gvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklisd
aeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqyghs
difggtpvvlgangveqvielqlnseekakfdeaiaetkrmkalah

Timeline for d4b7uc2:

• d4b7uc2 first appeared in SCOPe 2.03
  
• d4b7uc2 appears in SCOPe 2.05
  
• d4b7uc2 appears in the current release, SCOPe 2.08