Lineage for d4b7uc2 (4b7u C:165-329)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2556804Protein Lactate dehydrogenase [56339] (20 species)
  7. 2556987Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [56343] (14 PDB entries)
  8. 2557002Domain d4b7uc2: 4b7u C:165-329 [219361]
    Other proteins in same PDB: d4b7ua1, d4b7ua3, d4b7ub1, d4b7ub3, d4b7uc1, d4b7uc3, d4b7ud1, d4b7ud3
    automated match to d1t2da2
    complexed with bcn, ca, edo, mpd

Details for d4b7uc2

PDB Entry: 4b7u (more details), 1.88 Å

PDB Description: plasmodium falciparum l-lactate dehydrogenase complexed with bicine
PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d4b7uc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b7uc2 d.162.1.1 (C:165-329) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
gvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklisd
aeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqyghs
difggtpvvlgangveqvielqlnseekakfdeaiaetkrmkala

SCOPe Domain Coordinates for d4b7uc2:

Click to download the PDB-style file with coordinates for d4b7uc2.
(The format of our PDB-style files is described here.)

Timeline for d4b7uc2: