SCOPe 2.05: Domain d4b7ua1: 4b7u A:18-164

Lineage for d4b7ua1 (4b7u A:18-164)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (17 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (13 PDB entries)

8. Domain d4b7ua1: 4b7u A:18-164 [219356]
   Other proteins in same PDB: d4b7ua2, d4b7ub2, d4b7uc2, d4b7ud2
   automated match to d1t2da1
   complexed with bcn, ca, edo, mpd

Details for d4b7ua1

PDB Entry: 4b7u, 1.88 Å

PDB Description: plasmodium falciparum l-lactate dehydrogenase complexed with bicine

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d4b7ua1:

Sequence; same for both SEQRES and ATOM records:

>d4b7ua1 c.2.1.5 (A:18-164) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiiglg

Timeline for d4b7ua1:

• d4b7ua1 first appeared in SCOPe 2.03
  
• d4b7ua1 appears in SCOPe 2.04
  
• d4b7ua1 appears in SCOPe 2.06
  
• d4b7ua1 appears in the current release, SCOPe 2.08