Lineage for d4b7ud1 (4b7u D:18-164)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1829377Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1829416Protein Lactate dehydrogenase [51859] (17 species)
  7. 1829567Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (13 PDB entries)
  8. 1829580Domain d4b7ud1: 4b7u D:18-164 [219362]
    Other proteins in same PDB: d4b7ua2, d4b7ub2, d4b7uc2, d4b7ud2
    automated match to d1t2da1
    complexed with bcn, ca, edo, mpd

Details for d4b7ud1

PDB Entry: 4b7u (more details), 1.88 Å

PDB Description: plasmodium falciparum l-lactate dehydrogenase complexed with bicine
PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d4b7ud1:

Sequence, based on SEQRES records: (download)

>d4b7ud1 c.2.1.5 (D:18-164) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiiglg

Sequence, based on observed residues (ATOM records): (download)

>d4b7ud1 c.2.1.5 (D:18-164) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftrddllplnnkimieigghikkncpnafiivvtnpvdvm
vqllhqhsgvpknkiiglg

SCOPe Domain Coordinates for d4b7ud1:

Click to download the PDB-style file with coordinates for d4b7ud1.
(The format of our PDB-style files is described here.)

Timeline for d4b7ud1: