| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
| Protein Lactate dehydrogenase [56339] (19 species) |
| Species Lactobacillus casei [TaxId:1582] [56345] (6 PDB entries) |
| Domain d3vkvd2: 3vkv D:151-317 [217900] Other proteins in same PDB: d3vkva1, d3vkvb1, d3vkvc1, d3vkvd1, d3vkve1, d3vkvf1 automated match to d1llca2 complexed with fbp, so4 |
PDB Entry: 3vkv (more details), 2.7 Å
SCOPe Domain Sequences for d3vkvd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vkvd2 d.162.1.1 (D:151-317) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygl
ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdaf
Timeline for d3vkvd2: