Lineage for d3vkvd2 (3vkv D:151-317)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680348Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1680355Protein Lactate dehydrogenase [56339] (19 species)
  7. 1680437Species Lactobacillus casei [TaxId:1582] [56345] (6 PDB entries)
  8. 1680463Domain d3vkvd2: 3vkv D:151-317 [217900]
    Other proteins in same PDB: d3vkva1, d3vkvb1, d3vkvc1, d3vkvd1, d3vkve1, d3vkvf1
    automated match to d1llca2
    complexed with fbp, so4

Details for d3vkvd2

PDB Entry: 3vkv (more details), 2.7 Å

PDB Description: complex structure of lactobacillus casei lactate dehydrogenase with fructose-1,6-bisphosphate
PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3vkvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vkvd2 d.162.1.1 (D:151-317) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygl
ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdaf

SCOPe Domain Coordinates for d3vkvd2:

Click to download the PDB-style file with coordinates for d3vkvd2.
(The format of our PDB-style files is described here.)

Timeline for d3vkvd2: