Lineage for d1llca2 (1llc A:165-334)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
unusual fold, defines familySuperfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) 
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
automatically mapped to Pfam PF02866Protein Lactate dehydrogenase [56339] (19 species) 
Species Lactobacillus casei [TaxId:1582] [56345] (6 PDB entries) 
Domain d1llca2: 1llc A:165-334 [42143]
Other proteins in same PDB: d1llca1
complexed with afp, so4
Details for d1llca2
PDB Entry: 1llc (more details), 3 Å
PDB Description: structure determination of the allosteric l-lactate dehydrogenase from lactobacillus casei at 3.0 angstroms resolution
PDB Compounds: (A:) l-lactate dehydrogenaseSCOPe Domain Sequences for d1llca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygi
ndlyigtpavinrngiqnileipltdheeesmqksasqlkkvltdafakndi
SCOPe Domain Coordinates for d1llca2:
Click to download the PDB-style file with coordinates for d1llca2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1llca2:
- d1llca2 first appeared (with stable ids) in SCOP 1.55, called d1llc_2
- d1llca2 appears in SCOPe 2.03
- d1llca2 appears in SCOPe 2.05
- d1llca2 appears in the current release, SCOPe 2.08
View in 3D
