Lineage for d3vkve1 (3vkv E:7-150)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1579036Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1579075Protein Lactate dehydrogenase [51859] (18 species)
  7. 1579154Species Lactobacillus casei [TaxId:1582] [51865] (6 PDB entries)
  8. 1579181Domain d3vkve1: 3vkv E:7-150 [217901]
    Other proteins in same PDB: d3vkva2, d3vkvb2, d3vkvc2, d3vkvd2, d3vkve2, d3vkvf2
    automated match to d1llca1
    complexed with fbp, so4

Details for d3vkve1

PDB Entry: 3vkv (more details), 2.7 Å

PDB Description: complex structure of lactobacillus casei lactate dehydrogenase with fructose-1,6-bisphosphate
PDB Compounds: (E:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3vkve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vkve1 c.2.1.5 (E:7-150) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
kdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkki
ysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaan
pvdiltyatwklsgfpknrvvgsg

SCOPe Domain Coordinates for d3vkve1:

Click to download the PDB-style file with coordinates for d3vkve1.
(The format of our PDB-style files is described here.)

Timeline for d3vkve1: