Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.65: VPA0735-like [160934] (1 superfamily) consists of a cluster of helices and two beta-sandwich domains of similar topology; probable duplication |
Superfamily e.65.1: VPA0735-like [160935] (1 family) |
Family e.65.1.1: VPA0735-like [160936] (1 protein) the N-terminal beta-sandwich domain corresponds to Pfam PF06863 (DUF1254); the C-terminal beta-sandwich domains corresponds to Pfam PF06742 (DUF1214); the two Pfam families are structurally related |
Protein Hypothetical protein VPA0735 [160937] (1 species) |
Species Vibrio parahaemolyticus [TaxId:670] [160938] (2 PDB entries) Uniprot Q87I71 22-482 |
Domain d3vb9c_: 3vb9 C: [217741] automated match to d2p3ya1 complexed with mg |
PDB Entry: 3vb9 (more details), 2.1 Å
SCOPe Domain Sequences for d3vb9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vb9c_ e.65.1.1 (C:) Hypothetical protein VPA0735 {Vibrio parahaemolyticus [TaxId: 670]} etvvpsrvgdlkfesdfptqetmknmlnemdfqratqaylwgipassimewlnvsrndfk feegqmgffntlkqkqgiitanfttpyvigtwnlektgpliinlpeakmagmmldvhqrv lsdlsllgpdkgkggkylivppgekykdlnpkgyyvirpktnvvyggirilepdvdrvvk qvvpnittqpyadgklgrkipvaqvpeidwthipkdgleywktihqiiqenpveerdrfv maqlkflgiekgkpfnpteeqkkilleaskvgramaqsndytkrftqpywkgtnwkdais vsldqrsenydelderaawfyeaitvsrgmkstipgfgqrylvtyqdsdgnwlsgehtyk lhvpanvpasnfwsttvydennrlmiindagspdissrknlkvnsdgsidvyygpkpvkg yennwvqtnpgegwftyfrfygptekmfdkswtmgdielv
Timeline for d3vb9c_: