SCOPe 2.07: Domain d3vb9d_: 3vb9 D:

Lineage for d3vb9d_ (3vb9 D:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.65: VPA0735-like [160934] (1 superfamily)
   consists of a cluster of helices and two beta-sandwich domains of similar topology; probable duplication

4. Superfamily e.65.1: VPA0735-like [160935] (1 family)

5. Family e.65.1.1: VPA0735-like [160936] (1 protein)
   the N-terminal beta-sandwich domain corresponds to Pfam PF06863 (DUF1254); the C-terminal beta-sandwich domains corresponds to Pfam PF06742 (DUF1214); the two Pfam families are structurally related

6. Protein Hypothetical protein VPA0735 [160937] (1 species)

7. Species Vibrio parahaemolyticus [TaxId:670] [160938] (2 PDB entries)
   Uniprot Q87I71 22-482

8. Domain d3vb9d_: 3vb9 D: [217742]
   automated match to d2p3ya1
   complexed with mg

Details for d3vb9d_

PDB Entry: 3vb9, 2.1 Å

PDB Description: Crystal structure of VPA0735 from Vibrio parahaemolyticus in monoclinic form, NorthEast Structural Genomics target VpR109

PDB Compounds: (D:) Uncharacterized protein VPA0735

SCOPe Domain Sequences for d3vb9d_:

Sequence; same for both SEQRES and ATOM records:

>d3vb9d_ e.65.1.1 (D:) Hypothetical protein VPA0735 {Vibrio parahaemolyticus [TaxId: 670]}
etvvpsrvgdlkfesdfptqetmknmlnemdfqratqaylwgipassimewlnvsrndfk
feegqmgffntlkqkqgiitanfttpyvigtwnlektgpliinlpeakmagmmldvhqrv
lsdlsllgpdkgkggkylivppgekykdlnpkgyyvirpktnvvyggirilepdvdrvvk
qvvpnittqpyadgklgrkipvaqvpeidwthipkdgleywktihqiiqenpveerdrfv
maqlkflgiekgkpfnpteeqkkilleaskvgramaqsndytkrftqpywkgtnwkdais
vsldqrsenydelderaawfyeaitvsrgmkstipgfgqrylvtyqdsdgnwlsgehtyk
lhvpanvpasnfwsttvydennrlmiindagspdissrknlkvnsdgsidvyygpkpvkg
yennwvqtnpgegwftyfrfygptekmfdkswtmgdielv

Timeline for d3vb9d_:

• d3vb9d_ first appeared in SCOPe 2.03
  
• d3vb9d_ appears in SCOPe 2.06
  
• d3vb9d_ appears in the current release, SCOPe 2.08