Lineage for d3vb9a_ (3vb9 A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2626266Fold e.65: VPA0735-like [160934] (1 superfamily)
    consists of a cluster of helices and two beta-sandwich domains of similar topology; probable duplication
  4. 2626267Superfamily e.65.1: VPA0735-like [160935] (1 family) (S)
  5. 2626268Family e.65.1.1: VPA0735-like [160936] (1 protein)
    the N-terminal beta-sandwich domain corresponds to Pfam PF06863 (DUF1254); the C-terminal beta-sandwich domains corresponds to Pfam PF06742 (DUF1214); the two Pfam families are structurally related
  6. 2626269Protein Hypothetical protein VPA0735 [160937] (1 species)
  7. 2626270Species Vibrio parahaemolyticus [TaxId:670] [160938] (2 PDB entries)
    Uniprot Q87I71 22-482
  8. 2626273Domain d3vb9a_: 3vb9 A: [217739]
    automated match to d2p3ya1
    complexed with mg

Details for d3vb9a_

PDB Entry: 3vb9 (more details), 2.1 Å

PDB Description: Crystal structure of VPA0735 from Vibrio parahaemolyticus in monoclinic form, NorthEast Structural Genomics target VpR109
PDB Compounds: (A:) Uncharacterized protein VPA0735

SCOPe Domain Sequences for d3vb9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vb9a_ e.65.1.1 (A:) Hypothetical protein VPA0735 {Vibrio parahaemolyticus [TaxId: 670]}
etvvpsrvgdlkfesdfptqetmknmlnemdfqratqaylwgipassimewlnvsrndfk
feegqmgffntlkqkqgiitanfttpyvigtwnlektgpliinlpeakmagmmldvhqrv
lsdlsllgpdkgkggkylivppgekykdlnpkgyyvirpktnvvyggirilepdvdrvvk
qvvpnittqpyadgklgrkipvaqvpeidwthipkdgleywktihqiiqenpveerdrfv
maqlkflgiekgkpfnpteeqkkilleaskvgramaqsndytkrftqpywkgtnwkdais
vsldqrsenydelderaawfyeaitvsrgmkstipgfgqrylvtyqdsdgnwlsgehtyk
lhvpanvpasnfwsttvydennrlmiindagspdissrknlkvnsdgsidvyygpkpvkg
yennwvqtnpgegwftyfrfygptekmfdkswtmgdielv

SCOPe Domain Coordinates for d3vb9a_:

Click to download the PDB-style file with coordinates for d3vb9a_.
(The format of our PDB-style files is described here.)

Timeline for d3vb9a_: