Lineage for d1wipb3 (1wip B:98-178)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9355Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 9365Protein CD4 [49149] (2 species)
  7. 9366Species Human (Homo sapiens) [TaxId:9606] [49150] (12 PDB entries)
  8. 9382Domain d1wipb3: 1wip B:98-178 [21673]
    Other proteins in same PDB: d1wipa1, d1wipa2, d1wipb1, d1wipb2

Details for d1wipb3

PDB Entry: 1wip (more details), 4 Å

PDB Description: structure of t-cell surface glycoprotein cd4, monoclinic crystal form

SCOP Domain Sequences for d1wipb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wipb3 b.1.1.3 (B:98-178) CD4 {Human (Homo sapiens)}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOP Domain Coordinates for d1wipb3:

Click to download the PDB-style file with coordinates for d1wipb3.
(The format of our PDB-style files is described here.)

Timeline for d1wipb3: