Lineage for d1wipb2 (1wip B:179-291)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7022Protein CD4 [48737] (2 species)
  7. 7023Species Human (Homo sapiens) [TaxId:9606] [48738] (12 PDB entries)
  8. 7040Domain d1wipb2: 1wip B:179-291 [19735]
    Other proteins in same PDB: d1wipa3, d1wipa4, d1wipb3, d1wipb4

Details for d1wipb2

PDB Entry: 1wip (more details), 4 Å

PDB Description: structure of t-cell surface glycoprotein cd4, monoclinic crystal form

SCOP Domain Sequences for d1wipb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wipb2 b.1.1.1 (B:179-291) CD4 {Human (Homo sapiens)}
fqkassivykkegeqvefsfplaftvekltgsgelwwqaerassskswitfdlknkevsv
krvtqdpklqmgkklplhltlpqalpqyagsgnltlaleaktgklhqevnlvv

SCOP Domain Coordinates for d1wipb2:

Click to download the PDB-style file with coordinates for d1wipb2.
(The format of our PDB-style files is described here.)

Timeline for d1wipb2: