Lineage for d3s5za1 (3s5z A:32-323)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830250Protein Melibiase [75064] (4 species)
  7. 2830254Species Human (Homo sapiens) [TaxId:9606] [102062] (21 PDB entries)
    alpha-galactosidase A
  8. 2830257Domain d3s5za1: 3s5z A:32-323 [216223]
    Other proteins in same PDB: d3s5za2, d3s5zb2
    automated match to d1r46a2
    complexed with gal, gla, gol, nag

    missing some secondary structures that made up less than one-third of the common domain

Details for d3s5za1

PDB Entry: 3s5z (more details), 2 Å

PDB Description: pharmacological chaperoning in human alpha-galactosidase
PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d3s5za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s5za1 c.1.8.1 (A:32-323) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdp

SCOPe Domain Coordinates for d3s5za1:

Click to download the PDB-style file with coordinates for d3s5za1.
(The format of our PDB-style files is described here.)

Timeline for d3s5za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3s5za2