PDB entry 3s5z

View 3s5z on RCSB PDB site
Description: Pharmacological Chaperoning in Human alpha-Galactosidase
Class: hydrolase
Keywords: Glycoprotein, carbohydrate-binding protein, glycosidase, lysosomal enzyme, (beta/alpha)8 barrel, pharmacological chaperone, HYDROLASE
Deposited on 2011-05-23, released 2012-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-galactosidase A
    Species: Homo sapiens [TaxId:9606]
    Gene: GLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3s5za1, d3s5za2
  • Chain 'B':
    Compound: Alpha-galactosidase A
    Species: Homo sapiens [TaxId:9606]
    Gene: GLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3s5zb1, d3s5zb2
  • Heterogens: NAG, BMA, MAN, FUC, XYP, GLA, GAL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3s5zA (A:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentmqmslkdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s5zA (A:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3s5zB (B:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentmqmslkdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3s5zB (B:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentm