SCOPe 2.03: Domain d3s5za1: 3s5z A:32-323

Lineage for d3s5za1 (3s5z A:32-323)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Melibiase [75064] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102062] (11 PDB entries)
   alpha-galactosidase A

8. Domain d3s5za1: 3s5z A:32-323 [216223]
   Other proteins in same PDB: d3s5za2, d3s5zb2
   automated match to d1r46a2
   complexed with gal, gla, gol, nag

Details for d3s5za1

PDB Entry: 3s5z, 2 Å

PDB Description: pharmacological chaperoning in human alpha-galactosidase

PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d3s5za1:

Sequence; same for both SEQRES and ATOM records:

>d3s5za1 c.1.8.1 (A:32-323) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdp

Timeline for d3s5za1:

• d3s5za1 is new in SCOPe 2.03-stable
  
• d3s5za1 appears in SCOPe 2.04
  
• d3s5za1 appears in the current release, SCOPe 2.08