SCOPe 2.08: Domain d3qiua2: 3qiu A:82-181

Lineage for d3qiua2 (3qiu A:82-181)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3qiua2: 3qiu A:82-181 [215251]
   Other proteins in same PDB: d3qiua1, d3qiub1, d3qiub2, d3qiuc1, d3qiud1
   automated match to d2fsea1
   complexed with nag

Details for d3qiua2

PDB Entry: 3qiu, 2.7 Å

PDB Description: crystal structure of the 226 tcr in complex with mcc/i-ek

PDB Compounds: (A:) H-2 class II histocompatibility antigen, E-K alpha chain

SCOPe Domain Sequences for d3qiua2:

Sequence; same for both SEQRES and ATOM records:

>d3qiua2 b.1.1.2 (A:82-181) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefe

Timeline for d3qiua2:

• d3qiua2 first appeared in SCOPe 2.03
  
• d3qiua2 appears in SCOPe 2.07