![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
![]() | Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (11 PDB entries) probably orthologous to the human HLA-DR group |
![]() | Domain d3qiub2: 3qiu B:93-186 [215253] Other proteins in same PDB: d3qiua1, d3qiua2, d3qiub1, d3qiuc1, d3qiuc2, d3qiud1, d3qiud2 automated match to d1d5mb1 complexed with nag |
PDB Entry: 3qiu (more details), 2.7 Å
SCOPe Domain Sequences for d3qiub2:
Sequence, based on SEQRES records: (download)
>d3qiub2 b.1.1.2 (B:93-186) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd wtfqtlvmletvpqsgevytcqvehpsltdpvtv
>d3qiub2 b.1.1.2 (B:93-186) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} rrveptvtvyptllvcsvsdfypgnievrwfrkeektgivstglvrngdwtfqtlvmlet vytcqvehpsltdpvtv
Timeline for d3qiub2: