Lineage for d3qiub2 (3qiu B:93-186)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747484Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2747586Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (11 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 2747601Domain d3qiub2: 3qiu B:93-186 [215253]
    Other proteins in same PDB: d3qiua1, d3qiua2, d3qiub1, d3qiuc1, d3qiuc2, d3qiud1, d3qiud2
    automated match to d1d5mb1
    complexed with nag

Details for d3qiub2

PDB Entry: 3qiu (more details), 2.7 Å

PDB Description: crystal structure of the 226 tcr in complex with mcc/i-ek
PDB Compounds: (B:) MHC class II h2-ia-beta chain

SCOPe Domain Sequences for d3qiub2:

Sequence, based on SEQRES records: (download)

>d3qiub2 b.1.1.2 (B:93-186) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtv

Sequence, based on observed residues (ATOM records): (download)

>d3qiub2 b.1.1.2 (B:93-186) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rrveptvtvyptllvcsvsdfypgnievrwfrkeektgivstglvrngdwtfqtlvmlet
vytcqvehpsltdpvtv

SCOPe Domain Coordinates for d3qiub2:

Click to download the PDB-style file with coordinates for d3qiub2.
(The format of our PDB-style files is described here.)

Timeline for d3qiub2: