SCOPe 2.08: Domain d3qiub2: 3qiu B:93-186

Lineage for d3qiub2 (3qiu B:93-186)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (11 PDB entries)
   probably orthologous to the human HLA-DR group

8. Domain d3qiub2: 3qiu B:93-186 [215253]
   Other proteins in same PDB: d3qiua1, d3qiua2, d3qiub1, d3qiuc1, d3qiuc2, d3qiud1, d3qiud2
   automated match to d1d5mb1
   complexed with nag

Details for d3qiub2

PDB Entry: 3qiu, 2.7 Å

PDB Description: crystal structure of the 226 tcr in complex with mcc/i-ek

PDB Compounds: (B:) MHC class II h2-ia-beta chain

SCOPe Domain Sequences for d3qiub2:

Sequence, based on SEQRES records:

>d3qiub2 b.1.1.2 (B:93-186) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtv

Sequence, based on observed residues (ATOM records):

>d3qiub2 b.1.1.2 (B:93-186) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rrveptvtvyptllvcsvsdfypgnievrwfrkeektgivstglvrngdwtfqtlvmlet
vytcqvehpsltdpvtv

Timeline for d3qiub2:

• d3qiub2 first appeared in SCOPe 2.03
  
• d3qiub2 appears in SCOPe 2.07