Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d3qiuc2: 3qiu C:110-186 [215255] Other proteins in same PDB: d3qiua1, d3qiub1, d3qiub2, d3qiuc1, d3qiud1 automated match to d1qrnd2 complexed with nag |
PDB Entry: 3qiu (more details), 2.7 Å
SCOPe Domain Sequences for d3qiuc2:
Sequence, based on SEQRES records: (download)
>d3qiuc2 b.1.1.2 (C:110-186) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafn
>d3qiuc2 b.1.1.2 (C:110-186) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqdsdvyitdkcvldmrsmdfksnsav awsacanafn
Timeline for d3qiuc2: