SCOPe 2.08: Domain d3qiub1: 3qiu B:3-92

Lineage for d3qiub1 (3qiu B:3-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d3qiub1: 3qiu B:3-92 [215252]
   Other proteins in same PDB: d3qiua2, d3qiub2, d3qiuc1, d3qiuc2, d3qiud1, d3qiud2
   automated match to d2sebb2
   complexed with nag

Details for d3qiub1

PDB Entry: 3qiu, 2.7 Å

PDB Description: crystal structure of the 226 tcr in complex with mcc/i-ek

PDB Compounds: (B:) MHC class II h2-ia-beta chain

SCOPe Domain Sequences for d3qiub1:

Sequence; same for both SEQRES and ATOM records:

>d3qiub1 d.19.1.0 (B:3-92) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
srpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwn
sqpefleqkraevdtvcrhnyeifdnflvp

Timeline for d3qiub1:

• d3qiub1 first appeared in SCOPe 2.03
  
• d3qiub1 appears in SCOPe 2.07