Lineage for d3qiub1 (3qiu B:3-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938889Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)
  8. 2938949Domain d3qiub1: 3qiu B:3-92 [215252]
    Other proteins in same PDB: d3qiua2, d3qiub2, d3qiuc1, d3qiuc2, d3qiud1, d3qiud2
    automated match to d2sebb2
    complexed with nag

Details for d3qiub1

PDB Entry: 3qiu (more details), 2.7 Å

PDB Description: crystal structure of the 226 tcr in complex with mcc/i-ek
PDB Compounds: (B:) MHC class II h2-ia-beta chain

SCOPe Domain Sequences for d3qiub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qiub1 d.19.1.0 (B:3-92) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
srpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwn
sqpefleqkraevdtvcrhnyeifdnflvp

SCOPe Domain Coordinates for d3qiub1:

Click to download the PDB-style file with coordinates for d3qiub1.
(The format of our PDB-style files is described here.)

Timeline for d3qiub1: