SCOPe 2.08: Domain d3qiuc1: 3qiu C:2-109

Lineage for d3qiuc1 (3qiu C:2-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3qiuc1: 3qiu C:2-109 [215254]
   Other proteins in same PDB: d3qiua1, d3qiua2, d3qiub1, d3qiub2, d3qiuc2, d3qiud2
   automated match to d1qrnd1
   complexed with nag

Details for d3qiuc1

PDB Entry: 3qiu, 2.7 Å

PDB Description: crystal structure of the 226 tcr in complex with mcc/i-ek

PDB Compounds: (C:) TCR 226 alpha chain

SCOPe Domain Sequences for d3qiuc1:

Sequence; same for both SEQRES and ATOM records:

>d3qiuc1 b.1.1.0 (C:2-109) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qveqspsalslhegtgsalrcnftttmravqwfrknsrgslinlfylasgtkengrlksa
fdskerystlhirdaqledsgtyfcaaepssgqklvfgqgtilkvylh

Timeline for d3qiuc1:

• d3qiuc1 first appeared in SCOPe 2.03
  
• d3qiuc1 appears in SCOPe 2.07