SCOPe 2.08: Domain d3p0vm1: 3p0v M:1-107

Lineage for d3p0vm1 (3p0v M:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3p0vm1: 3p0v M:1-107 [214616]
   Other proteins in same PDB: d3p0vh_, d3p0vi_, d3p0vl2, d3p0vm2
   automated match to d1rhha1
   complexed with ca

Details for d3p0vm1

PDB Entry: 3p0v, 2.85 Å

PDB Description: anti-EGFR/HER3 Fab DL11 alone

PDB Compounds: (M:) Fab DL11 light chain

SCOPe Domain Sequences for d3p0vm1:

Sequence; same for both SEQRES and ATOM records:

>d3p0vm1 b.1.1.0 (M:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdlatdvawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqsepepytfgqgtkveik

Timeline for d3p0vm1:

• d3p0vm1 first appeared in SCOPe 2.03
  
• d3p0vm1 appears in SCOPe 2.07