Lineage for d1rhha1 (1rhh A:1-106A)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries)
  8. Domain d1rhha1: 1rhh A:1-106A [97473]
    Other proteins in same PDB: d1rhha2, d1rhhb1, d1rhhb2, d1rhhc2, d1rhhd1, d1rhhd2
    part of HIV-1 neutralizing Fab x5

Details for d1rhha1

PDB Entry: 1rhh (more details), 1.9 Å

PDB Description: Crystal Structure of the Broadly HIV-1 Neutralizing Fab X5 at 1.90 Angstrom Resolution
PDB Compounds: (A:) Fab X5, light chain

SCOPe Domain Sequences for d1rhha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhha1 b.1.1.1 (A:1-106A) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
elvltqspgtlslsageratlscrasqsvssgslawyqqkpgqaprlliygastratgip
drfsgsgsgtdftltigrlepedlavyycqqygtspytfgqgtkleik

SCOPe Domain Coordinates for d1rhha1 are not available.

Timeline for d1rhha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rhha2
View in 3D
Domains from other chains:
(mouse over for more information)
d1rhhb1, d1rhhb2, d1rhhc1, d1rhhc2, d1rhhd1, d1rhhd2