Lineage for d3p0vi_ (3p0v I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (705 PDB entries)
  8. 2743058Domain d3p0vi_: 3p0v I: [408579]
    Other proteins in same PDB: d3p0vl1, d3p0vl2, d3p0vm1, d3p0vm2
    automated match to d6shgh_
    complexed with ca

Details for d3p0vi_

PDB Entry: 3p0v (more details), 2.85 Å

PDB Description: anti-EGFR/HER3 Fab DL11 alone
PDB Compounds: (I:) Fab DL11 heavy chain

SCOPe Domain Sequences for d3p0vi_:

Sequence, based on SEQRES records: (download)

>d3p0vi_ b.1.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftlsgdwihwvrqapgkglewlgeisaaggytdy
adsvkgrftisadtskntaylqmnslraedtavyycaresrvsfeaamdywgqgtlvtvs
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records): (download)

>d3p0vi_ b.1.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftlsgdwihwvrqapgkglewlgeisaaggytdy
adsvkgrftisadtskntaylqmnslraedtavyycaresrvsfeaamdywgqgtlvtvs
sastkgpsvfplapssksgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d3p0vi_:

Click to download the PDB-style file with coordinates for d3p0vi_.
(The format of our PDB-style files is described here.)

Timeline for d3p0vi_:

  • d3p0vi_ is new in SCOPe 2.08-stable