Lineage for d3p0vm1 (3p0v M:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296627Domain d3p0vm1: 3p0v M:1-107 [214616]
    Other proteins in same PDB: d3p0vl2, d3p0vm2
    automated match to d1rhha1
    complexed with ca

Details for d3p0vm1

PDB Entry: 3p0v (more details), 2.85 Å

PDB Description: anti-EGFR/HER3 Fab DL11 alone
PDB Compounds: (M:) Fab DL11 light chain

SCOPe Domain Sequences for d3p0vm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p0vm1 b.1.1.0 (M:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdlatdvawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqsepepytfgqgtkveik

SCOPe Domain Coordinates for d3p0vm1:

Click to download the PDB-style file with coordinates for d3p0vm1.
(The format of our PDB-style files is described here.)

Timeline for d3p0vm1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p0vm2