SCOP 1.63: Domain d1ejoh2: 1ejo H:2620-2719

Lineage for d1ejoh2 (1ejo H:2620-2719)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-FMDV Fab 4C4, (mouse), kappa L chain [49097] (1 PDB entry)

8. Domain d1ejoh2: 1ejo H:2620-2719 [21399]
   Other proteins in same PDB: d1ejoh1, d1ejol1

Details for d1ejoh2

PDB Entry: 1ejo, 2.3 Å

PDB Description: fab fragment of neutralising monoclonal antibody 4c4 complexed with g- h loop from fmdv.

SCOP Domain Sequences for d1ejoh2:

Sequence, based on SEQRES records:

>d1ejoh2 b.1.1.2 (H:2620-2719) Immunoglobulin (constant domains of L and H chains) {Anti-FMDV Fab 4C4, (mouse), kappa L chain}
akttapsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records):

>d1ejoh2 b.1.1.2 (H:2620-2719) Immunoglobulin (constant domains of L and H chains) {Anti-FMDV Fab 4C4, (mouse), kappa L chain}
akttapsvyplapvcgsvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
ssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d1ejoh2:

• d1ejoh2 first appeared (with stable ids) in SCOP 1.55
  
• d1ejoh2 appears in SCOP 1.61
  
• d1ejoh2 appears in SCOP 1.65
  
• d1ejoh2 appears in the current release, SCOPe 2.08