| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
| Species Anti-FMDV Fab 4C4, (mouse), kappa L chain [49097] (1 PDB entry) |
| Domain d1ejol2: 1ejo L:2112-2216 [21398] Other proteins in same PDB: d1ejoh1, d1ejol1 |
PDB Entry: 1ejo (more details), 2.3 Å
SCOP Domain Sequences for d1ejol2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ejol2 b.1.1.2 (L:2112-2216) Immunoglobulin (constant domains of L and H chains) {Anti-FMDV Fab 4C4, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra
Timeline for d1ejol2: