Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (29 species) not a true protein |
Species Desulfococcus multivorans [TaxId:897] [225943] (2 PDB entries) |
Domain d3mpje1: 3mpj E:1-231 [213525] Other proteins in same PDB: d3mpja2, d3mpjb2, d3mpjb3, d3mpjd2, d3mpjd3, d3mpje2, d3mpje3, d3mpjf2, d3mpjf3, d3mpjg2 automated match to d3mdea2 complexed with cl, fad |
PDB Entry: 3mpj (more details), 2.1 Å
SCOPe Domain Sequences for d3mpje1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mpje1 e.6.1.0 (E:1-231) automated matches {Desulfococcus multivorans [TaxId: 897]} mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkp
Timeline for d3mpje1: