Lineage for d3mpje1 (3mpj E:1-231)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451317Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1451318Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1451455Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1451456Protein automated matches [226934] (14 species)
    not a true protein
  7. 1451498Species Desulfococcus multivorans [TaxId:897] [225943] (2 PDB entries)
  8. 1451506Domain d3mpje1: 3mpj E:1-231 [213525]
    Other proteins in same PDB: d3mpja2, d3mpjb2, d3mpjd2, d3mpje2, d3mpjf2, d3mpjg2
    automated match to d3mdea2
    complexed with cl, fad

Details for d3mpje1

PDB Entry: 3mpj (more details), 2.1 Å

PDB Description: Structure of the glutaryl-coenzyme A dehydrogenase
PDB Compounds: (E:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3mpje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mpje1 e.6.1.0 (E:1-231) automated matches {Desulfococcus multivorans [TaxId: 897]}
mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkp

SCOPe Domain Coordinates for d3mpje1:

Click to download the PDB-style file with coordinates for d3mpje1.
(The format of our PDB-style files is described here.)

Timeline for d3mpje1: