Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (30 species) not a true protein |
Species Desulfococcus multivorans [TaxId:897] [225944] (2 PDB entries) |
Domain d3mpja2: 3mpj A:232-389 [213520] Other proteins in same PDB: d3mpja1, d3mpjb1, d3mpjb3, d3mpjd1, d3mpjd3, d3mpje1, d3mpje3, d3mpjf1, d3mpjf3, d3mpjg1 automated match to d3mdea1 complexed with cl, fad |
PDB Entry: 3mpj (more details), 2.1 Å
SCOPe Domain Sequences for d3mpja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mpja2 a.29.3.0 (A:232-389) automated matches {Desulfococcus multivorans [TaxId: 897]} gdgarivfgslnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqm aveveaarllaykaaaakdegrlnngldvamakyaageavskcanyamrilgaygystey pvarfyrdaptyymvegsanickmiialdqlgvrkanr
Timeline for d3mpja2: