Lineage for d3mpjd1 (3mpj D:1-231)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2621090Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2621091Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2621236Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2621237Protein automated matches [226934] (29 species)
    not a true protein
  7. 2621323Species Desulfococcus multivorans [TaxId:897] [225943] (2 PDB entries)
  8. 2621330Domain d3mpjd1: 3mpj D:1-231 [213523]
    Other proteins in same PDB: d3mpja2, d3mpjb2, d3mpjb3, d3mpjd2, d3mpjd3, d3mpje2, d3mpje3, d3mpjf2, d3mpjf3, d3mpjg2
    automated match to d3mdea2
    complexed with cl, fad

Details for d3mpjd1

PDB Entry: 3mpj (more details), 2.1 Å

PDB Description: Structure of the glutaryl-coenzyme A dehydrogenase
PDB Compounds: (D:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3mpjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mpjd1 e.6.1.0 (D:1-231) automated matches {Desulfococcus multivorans [TaxId: 897]}
mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkp

SCOPe Domain Coordinates for d3mpjd1:

Click to download the PDB-style file with coordinates for d3mpjd1.
(The format of our PDB-style files is described here.)

Timeline for d3mpjd1: