SCOPe 2.08: Domain d3ml1a2: 3ml1 A:682-802

Lineage for d3ml1a2 (3ml1 A:682-802)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.0: automated matches [191648] (1 protein)
   not a true family

6. Protein automated matches [191195] (10 species)
   not a true protein

7. Species Ralstonia eutropha [TaxId:381666] [226102] (2 PDB entries)

8. Domain d3ml1a2: 3ml1 A:682-802 [213317]
   Other proteins in same PDB: d3ml1a1
   automated match to d1ogya1
   complexed with hec, mgd, mos, sf4

Details for d3ml1a2

PDB Entry: 3ml1, 1.6 Å

PDB Description: Crystal Structure of the Periplasmic Nitrate Reductase from Cupriavidus necator

PDB Compounds: (A:) periplasmic nitrate reductase

SCOPe Domain Sequences for d3ml1a2:

Sequence; same for both SEQRES and ATOM records:

>d3ml1a2 b.52.2.0 (A:682-802) automated matches {Ralstonia eutropha [TaxId: 381666]}
pdkeypywlvtgrvlehwhsgsmtrrvpelyrsfpnavvfmhpedakalglrrgvevevv
srrgrmrsrietrgrdapprglvfvpwfdasqlinkvtldatcpislqtdfkkcavkivk
v

Timeline for d3ml1a2:

• d3ml1a2 first appeared in SCOPe 2.03
  
• d3ml1a2 appears in SCOPe 2.07