PDB entry 3ml1

View 3ml1 on RCSB PDB site
Description: Crystal Structure of the Periplasmic Nitrate Reductase from Cupriavidus necator
Class: oxidoreductase
Keywords: Heterodimer, Oxidoreductase
Deposited on 2010-04-16, released 2011-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.159
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmic nitrate reductase
    Species: Ralstonia eutropha [TaxId:381666]
    Gene: napAB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ml1a1, d3ml1a2
  • Chain 'B':
    Compound: diheme cytochrome c napb
    Species: Ralstonia eutropha [TaxId:381666]
    Gene: napB
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SF4, MOS, MGD, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ml1A (A:)
    anfvtdsevtklkwskapcrfcgtgcgvtvavkdnkvvatqgdpqaevnkglncvkgyfl
    skimygqdrltrplmrmkngkydkngdfapvtwdqafdemerqfkrvlkekgptavgmfg
    sgqwtvwegyaaaklykagfrsnnidpnarhcmasaaagfmrtfgmdepmgcyddfeaad
    afvlwgsnmaemhpilwtrvtdrrlshpktrvvvlstfthrcfdladigiifkpqtdlam
    lnyianyiirnnkvnkdfvnkhtvfkegvtdigyglrpdhplqkaaknasdpgaakvitf
    defakfvskydadyvsklsavpkakldqlaelyadpnikvmslwtmgfnqhtrgtwannm
    vynlhlltgkiatpgnspfsltgqpsacgtarevgtfshrlpadmvvtnpkhreeaeriw
    klppgtipdkpgydavlqnrmlkdgklnaywvqvnnnmqaaanlmeeglpgyrnpanfiv
    vsdayptvtalaadlvlpsamwvekegaygnaerrtqfwhqlvdapgearsdlwqlvefa
    krfkveevwppeliakkpeykgktlydvlyrngqvdkfplkdvnaeyhnaeakafgfylq
    kglfeeyatfgrghghdlapfdayhearglrwpvvngketrwryregsdpyvkagtgfqf
    ygnpdgkavifalpyeppaespdkeypywlvtgrvlehwhsgsmtrrvpelyrsfpnavv
    fmhpedakalglrrgvevevvsrrgrmrsrietrgrdapprglvfvpwfdasqlinkvtl
    datcpislqtdfkkcavkivkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ml1A (A:)
    vtdsevtklkwskapcrfcgtgcgvtvavkdnkvvatqgdpqaevnkglncvkgyflski
    mygqdrltrplmrmkngkydkngdfapvtwdqafdemerqfkrvlkekgptavgmfgsgq
    wtvwegyaaaklykagfrsnnidpnarhcmasaaagfmrtfgmdepmgcyddfeaadafv
    lwgsnmaemhpilwtrvtdrrlshpktrvvvlstfthrcfdladigiifkpqtdlamlny
    ianyiirnnkvnkdfvnkhtvfkegvtdigyglrpdhplqkaaknasdpgaakvitfdef
    akfvskydadyvsklsavpkakldqlaelyadpnikvmslwtmgfnqhtrgtwannmvyn
    lhlltgkiatpgnspfsltgqpsacgtarevgtfshrlpadmvvtnpkhreeaeriwklp
    pgtipdkpgydavlqnrmlkdgklnaywvqvnnnmqaaanlmeeglpgyrnpanfivvsd
    ayptvtalaadlvlpsamwvekegaygnaerrtqfwhqlvdapgearsdlwqlvefakrf
    kveevwppeliakkpeykgktlydvlyrngqvdkfplkdvnaeyhnaeakafgfylqkgl
    feeyatfgrghghdlapfdayhearglrwpvvngketrwryregsdpyvkagtgfqfygn
    pdgkavifalpyeppaespdkeypywlvtgrvlehwhsgsmtrrvpelyrsfpnavvfmh
    pedakalglrrgvevevvsrrgrmrsrietrgrdapprglvfvpwfdasqlinkvtldat
    cpislqtdfkkcavkivkv
    

  • Chain 'B':
    No sequence available.