Lineage for d3ml1a1 (3ml1 A:4-681)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140533Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2140534Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 2140535Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 protein domains)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2140649Protein automated matches [227025] (4 species)
    not a true protein
  7. 2140659Species Ralstonia eutropha [TaxId:381666] [226101] (2 PDB entries)
  8. 2140660Domain d3ml1a1: 3ml1 A:4-681 [213316]
    Other proteins in same PDB: d3ml1a2
    automated match to d1ogya2
    complexed with hec, mgd, mos, sf4

Details for d3ml1a1

PDB Entry: 3ml1 (more details), 1.6 Å

PDB Description: Crystal Structure of the Periplasmic Nitrate Reductase from Cupriavidus necator
PDB Compounds: (A:) periplasmic nitrate reductase

SCOPe Domain Sequences for d3ml1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ml1a1 c.81.1.1 (A:4-681) automated matches {Ralstonia eutropha [TaxId: 381666]}
vtdsevtklkwskapcrfcgtgcgvtvavkdnkvvatqgdpqaevnkglncvkgyflski
mygqdrltrplmrmkngkydkngdfapvtwdqafdemerqfkrvlkekgptavgmfgsgq
wtvwegyaaaklykagfrsnnidpnarhcmasaaagfmrtfgmdepmgcyddfeaadafv
lwgsnmaemhpilwtrvtdrrlshpktrvvvlstfthrcfdladigiifkpqtdlamlny
ianyiirnnkvnkdfvnkhtvfkegvtdigyglrpdhplqkaaknasdpgaakvitfdef
akfvskydadyvsklsavpkakldqlaelyadpnikvmslwtmgfnqhtrgtwannmvyn
lhlltgkiatpgnspfsltgqpsacgtarevgtfshrlpadmvvtnpkhreeaeriwklp
pgtipdkpgydavlqnrmlkdgklnaywvqvnnnmqaaanlmeeglpgyrnpanfivvsd
ayptvtalaadlvlpsamwvekegaygnaerrtqfwhqlvdapgearsdlwqlvefakrf
kveevwppeliakkpeykgktlydvlyrngqvdkfplkdvnaeyhnaeakafgfylqkgl
feeyatfgrghghdlapfdayhearglrwpvvngketrwryregsdpyvkagtgfqfygn
pdgkavifalpyeppaes

SCOPe Domain Coordinates for d3ml1a1:

Click to download the PDB-style file with coordinates for d3ml1a1.
(The format of our PDB-style files is described here.)

Timeline for d3ml1a1: