Class b: All beta proteins [48724] (178 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.0: automated matches [191648] (1 protein) not a true family |
Protein automated matches [191195] (10 species) not a true protein |
Species Ralstonia eutropha [TaxId:381666] [226102] (2 PDB entries) |
Domain d3ml1a2: 3ml1 A:682-802 [213317] Other proteins in same PDB: d3ml1a1 automated match to d1ogya1 complexed with hec, mgd, mos, sf4 |
PDB Entry: 3ml1 (more details), 1.6 Å
SCOPe Domain Sequences for d3ml1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ml1a2 b.52.2.0 (A:682-802) automated matches {Ralstonia eutropha [TaxId: 381666]} pdkeypywlvtgrvlehwhsgsmtrrvpelyrsfpnavvfmhpedakalglrrgvevevv srrgrmrsrietrgrdapprglvfvpwfdasqlinkvtldatcpislqtdfkkcavkivk v
Timeline for d3ml1a2: