Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
Protein automated matches [227030] (3 species) not a true protein |
Species Yersinia pestis [TaxId:214092] [225855] (1 PDB entry) |
Domain d3lxma1: 3lxm A:2-151 [213087] Other proteins in same PDB: d3lxma2, d3lxmb2, d3lxmc2 automated match to d1ekxa1 complexed with pg4 |
PDB Entry: 3lxm (more details), 2 Å
SCOPe Domain Sequences for d3lxma1:
Sequence, based on SEQRES records: (download)
>d3lxma1 c.78.1.1 (A:2-151) automated matches {Yersinia pestis [TaxId: 214092]} anplyhkhiisindlsrdelelvlrtaaslkktpqpellkhkviascffeastrtrlsfe tsihrlgasvvgfsdssntslgkkgetladtmsvistyvdaivmrhpqegasrlaaqfsg nvpivnagdganqhptqtlldlftiqetqg
>d3lxma1 c.78.1.1 (A:2-151) automated matches {Yersinia pestis [TaxId: 214092]} anplyhkhiisindlsrdelelvlrtaaslkktpqpellkhkviascffeastrtrlsfe tsihrlgasvvgfsdgetladtmsvistyvdaivmrhpqegasrlaaqfsgnvpivnagd ganqhptqtlldlftiqetqg
Timeline for d3lxma1:
View in 3D Domains from other chains: (mouse over for more information) d3lxmb1, d3lxmb2, d3lxmc1, d3lxmc2 |