Lineage for d3lxmb1 (3lxm B:2-151)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2513850Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2514290Protein automated matches [227030] (3 species)
    not a true protein
  7. 2514300Species Yersinia pestis [TaxId:214092] [225855] (1 PDB entry)
  8. 2514302Domain d3lxmb1: 3lxm B:2-151 [213089]
    Other proteins in same PDB: d3lxma2, d3lxmb2, d3lxmc2
    automated match to d1ekxa1
    complexed with pg4

Details for d3lxmb1

PDB Entry: 3lxm (more details), 2 Å

PDB Description: 2.00 angstrom resolution crystal structure of a catalytic subunit of an aspartate carbamoyltransferase (pyrb) from yersinia pestis co92
PDB Compounds: (B:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d3lxmb1:

Sequence, based on SEQRES records: (download)

>d3lxmb1 c.78.1.1 (B:2-151) automated matches {Yersinia pestis [TaxId: 214092]}
anplyhkhiisindlsrdelelvlrtaaslkktpqpellkhkviascffeastrtrlsfe
tsihrlgasvvgfsdssntslgkkgetladtmsvistyvdaivmrhpqegasrlaaqfsg
nvpivnagdganqhptqtlldlftiqetqg

Sequence, based on observed residues (ATOM records): (download)

>d3lxmb1 c.78.1.1 (B:2-151) automated matches {Yersinia pestis [TaxId: 214092]}
anplyhkhiisindlsrdelelvlrtaaslkktpqpellkhkviascffeastrtrlsfe
tsihrlgasvvgfsdstladtmsvistyvdaivmrhpqegasrlaaqfsgnvpivnagdg
anqhptqtlldlftiqetqg

SCOPe Domain Coordinates for d3lxmb1:

Click to download the PDB-style file with coordinates for d3lxmb1.
(The format of our PDB-style files is described here.)

Timeline for d3lxmb1: