Lineage for d3lxmc2 (3lxm C:152-308)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2514304Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2514305Protein automated matches [226938] (26 species)
    not a true protein
  7. 2514736Species Yersinia pestis [TaxId:214092] [225856] (1 PDB entry)
  8. 2514739Domain d3lxmc2: 3lxm C:152-308 [213092]
    Other proteins in same PDB: d3lxma1, d3lxmb1, d3lxmc1
    automated match to d1ekxa2
    complexed with pg4

Details for d3lxmc2

PDB Entry: 3lxm (more details), 2 Å

PDB Description: 2.00 angstrom resolution crystal structure of a catalytic subunit of an aspartate carbamoyltransferase (pyrb) from yersinia pestis co92
PDB Compounds: (C:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d3lxmc2:

Sequence, based on SEQRES records: (download)

>d3lxmc2 c.78.1.0 (C:152-308) automated matches {Yersinia pestis [TaxId: 214092]}
rldniniamvgdlkygrtvhsltqalakfngnhfffiapdalampayilqmleekeieys
lhesleevvpeldilymtrvqkerldpseyanvkaqfilrssdltgardnlkvlhplpri
deittdvdktpyayyfqqagngifarqallalvlnae

Sequence, based on observed residues (ATOM records): (download)

>d3lxmc2 c.78.1.0 (C:152-308) automated matches {Yersinia pestis [TaxId: 214092]}
rldniniamvgdlkygrtvhsltqalakfngnhfffiapdalampayilqmleekeieys
lhesleevvpeldilymtilrssdltgardnlkvlhplprideittdvdktpyayyfqqa
gngifarqallalvlnae

SCOPe Domain Coordinates for d3lxmc2:

Click to download the PDB-style file with coordinates for d3lxmc2.
(The format of our PDB-style files is described here.)

Timeline for d3lxmc2: