SCOPe 2.07: Domain d3lacb_: 3lac B:

Lineage for d3lacb_ (3lac B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families)

5. Family c.56.4.0: automated matches [191433] (1 protein)
   not a true family

6. Protein automated matches [190623] (6 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225814] (1 PDB entry)

8. Domain d3lacb_: 3lac B: [212765]
   automated match to d4gxhb_
   complexed with mg, peg

Details for d3lacb_

PDB Entry: 3lac, 2 Å

PDB Description: Crystal structure of Bacillus anthracis pyrrolidone-carboxylate peptidase, pcP

PDB Compounds: (B:) Pyrrolidone-carboxylate peptidase

SCOPe Domain Sequences for d3lacb_:

Sequence; same for both SEQRES and ATOM records:

>d3lacb_ c.56.4.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mktvlltgfdpfggesinpawevakslhektigeykiiskqvptvfhksisvlkeyieel
apefiicigqaggrpditiervainiddariadnegnqpvdvpvveegpaaywstlpmka
ivkklqeegipasvsqtagtfvcnhlfyglmhelekhdtkmkggfihipflpeqasnypg
qpsmslstirkgielavevtttve

Timeline for d3lacb_:

• d3lacb_ first appeared in SCOPe 2.03
  
• d3lacb_ appears in SCOPe 2.06
  
• d3lacb_ appears in the current release, SCOPe 2.08