Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) |
Family c.56.4.0: automated matches [191433] (1 protein) not a true family |
Protein automated matches [190623] (4 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225814] (1 PDB entry) |
Domain d3lacb_: 3lac B: [212765] automated match to d4gxhb_ complexed with mg, peg |
PDB Entry: 3lac (more details), 2 Å
SCOPe Domain Sequences for d3lacb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lacb_ c.56.4.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mktvlltgfdpfggesinpawevakslhektigeykiiskqvptvfhksisvlkeyieel apefiicigqaggrpditiervainiddariadnegnqpvdvpvveegpaaywstlpmka ivkklqeegipasvsqtagtfvcnhlfyglmhelekhdtkmkggfihipflpeqasnypg qpsmslstirkgielavevtttve
Timeline for d3lacb_: