Lineage for d4gxhb_ (4gxh B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497212Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 2497275Family c.56.4.0: automated matches [191433] (1 protein)
    not a true family
  6. 2497276Protein automated matches [190623] (6 species)
    not a true protein
  7. 2497298Species Xenorhabdus bovienii [TaxId:406818] [193515] (2 PDB entries)
  8. 2497304Domain d4gxhb_: 4gxh B: [193516]
    automated match to d3ro0b_
    complexed with cl, po4

Details for d4gxhb_

PDB Entry: 4gxh (more details), 2.7 Å

PDB Description: Crystal Structure of a Pyrrolidone-carboxylate peptidase 1 (target ID NYSGRC-012831) from Xenorhabdus bovienii SS-2004
PDB Compounds: (B:) Pyrrolidone-carboxylate peptidase

SCOPe Domain Sequences for d4gxhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gxhb_ c.56.4.0 (B:) automated matches {Xenorhabdus bovienii [TaxId: 406818]}
mktilvtafdpfggeainpsweaikplqgsqvfganieicqipcifdtslehlyaavdky
qpelvisvgqaggrtnitvervainindaripdnagnqpidtpvivdgpaayfsrlpikt
mvnalntagipasvsqtagtfvcnhvmygllhylaqntpsvrggfihvpylpeqavkdgn
qssmtlmlmtlalkiaietawknts

SCOPe Domain Coordinates for d4gxhb_:

Click to download the PDB-style file with coordinates for d4gxhb_.
(The format of our PDB-style files is described here.)

Timeline for d4gxhb_: