Lineage for d3hn3e3 (3hn3 E:329-632)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830874Protein beta-Glucuronidase, domain 3 [51512] (1 species)
  7. 2830875Species Human (Homo sapiens) [TaxId:9606] [51513] (2 PDB entries)
  8. 2830879Domain d3hn3e3: 3hn3 E:329-632 [211145]
    Other proteins in same PDB: d3hn3a1, d3hn3a2, d3hn3b1, d3hn3b2, d3hn3d1, d3hn3d2, d3hn3e1, d3hn3e2
    automated match to d1bhga3
    complexed with bma, mpd, mrd, nag

Details for d3hn3e3

PDB Entry: 3hn3 (more details), 1.7 Å

PDB Description: human beta-glucuronidase at 1.7 a resolution
PDB Compounds: (E:) beta-glucuronidase

SCOPe Domain Sequences for d3hn3e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hn3e3 c.1.8.3 (E:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]}
vavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlganafrtshypy
aeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknhpavvmwsv
anepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdviclnsyyswy
hdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmfteeyqkslleq
yhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaafllrerywk
iane

SCOPe Domain Coordinates for d3hn3e3:

Click to download the PDB-style file with coordinates for d3hn3e3.
(The format of our PDB-style files is described here.)

Timeline for d3hn3e3: