![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
![]() | Protein beta-Glucuronidase [49307] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49308] (2 PDB entries) |
![]() | Domain d3hn3e2: 3hn3 E:226-328 [211144] Other proteins in same PDB: d3hn3a1, d3hn3a3, d3hn3b1, d3hn3b3, d3hn3d1, d3hn3d3, d3hn3e1, d3hn3e3 automated match to d1bhga1 complexed with bma, mpd, mrd, nag |
PDB Entry: 3hn3 (more details), 1.7 Å
SCOPe Domain Sequences for d3hn3e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hn3e2 b.1.4.1 (E:226-328) beta-Glucuronidase {Human (Homo sapiens) [TaxId: 9606]} tyidditvttsveqdsglvnyqisvkgsnlfklevrlldaenkvvangtgtqgqlkvpgv slwwpylmherpaylyslevqltaqtslgpvsdfytlpvgirt
Timeline for d3hn3e2: