Lineage for d3hn3d2 (3hn3 D:226-328)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762431Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2762886Protein beta-Glucuronidase [49307] (1 species)
  7. 2762887Species Human (Homo sapiens) [TaxId:9606] [49308] (2 PDB entries)
  8. 2762890Domain d3hn3d2: 3hn3 D:226-328 [211141]
    Other proteins in same PDB: d3hn3a1, d3hn3a3, d3hn3b1, d3hn3b3, d3hn3d1, d3hn3d3, d3hn3e1, d3hn3e3
    automated match to d1bhga1
    complexed with bma, mpd, mrd, nag

Details for d3hn3d2

PDB Entry: 3hn3 (more details), 1.7 Å

PDB Description: human beta-glucuronidase at 1.7 a resolution
PDB Compounds: (D:) beta-glucuronidase

SCOPe Domain Sequences for d3hn3d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hn3d2 b.1.4.1 (D:226-328) beta-Glucuronidase {Human (Homo sapiens) [TaxId: 9606]}
tyidditvttsveqdsglvnyqisvkgsnlfklevrlldaenkvvangtgtqgqlkvpgv
slwwpylmherpaylyslevqltaqtslgpvsdfytlpvgirt

SCOPe Domain Coordinates for d3hn3d2:

Click to download the PDB-style file with coordinates for d3hn3d2.
(The format of our PDB-style files is described here.)

Timeline for d3hn3d2: