![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein beta-Glucuronidase, domain 3 [51512] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [51513] (2 PDB entries) |
![]() | Domain d3hn3b3: 3hn3 B:329-633 [211139] Other proteins in same PDB: d3hn3a1, d3hn3a2, d3hn3b1, d3hn3b2, d3hn3d1, d3hn3d2, d3hn3e1, d3hn3e2 automated match to d1bhga3 complexed with bma, gup, man, mpd, mrd, nag, ndg |
PDB Entry: 3hn3 (more details), 1.7 Å
SCOPe Domain Sequences for d3hn3b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hn3b3 c.1.8.3 (B:329-633) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} vavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlganafrtshypy aeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknhpavvmwsv anepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdviclnsyyswy hdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmfteeyqkslleq yhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaafllrerywk ianet
Timeline for d3hn3b3: