Lineage for d3hn3d1 (3hn3 D:23-225)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039145Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2039146Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2039263Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 protein domains)
  6. 2039473Protein beta-Glucuronidase [49806] (1 species)
  7. 2039474Species Human (Homo sapiens) [TaxId:9606] [49807] (2 PDB entries)
  8. 2039477Domain d3hn3d1: 3hn3 D:23-225 [211140]
    Other proteins in same PDB: d3hn3a2, d3hn3a3, d3hn3b2, d3hn3b3, d3hn3d2, d3hn3d3, d3hn3e2, d3hn3e3
    automated match to d1bhga2
    complexed with bma, mpd, mrd, nag, ndg

Details for d3hn3d1

PDB Entry: 3hn3 (more details), 1.7 Å

PDB Description: human beta-glucuronidase at 1.7 a resolution
PDB Compounds: (D:) beta-glucuronidase

SCOPe Domain Sequences for d3hn3d1:

Sequence, based on SEQRES records: (download)

>d3hn3d1 b.18.1.5 (D:23-225) beta-Glucuronidase {Human (Homo sapiens) [TaxId: 9606]}
lqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvpss
fndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtleh
eggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyfvq
ntyfdffnyaglqrsvllyttpt

Sequence, based on observed residues (ATOM records): (download)

>d3hn3d1 b.18.1.5 (D:23-225) beta-Glucuronidase {Human (Homo sapiens) [TaxId: 9606]}
lqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvpss
fndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtleh
eggylpfeadisnlvqvsrlritiainntltpttlppgtiqyltdtskypkgyfvqntyf
dffnyaglqrsvllyttpt

SCOPe Domain Coordinates for d3hn3d1:

Click to download the PDB-style file with coordinates for d3hn3d1.
(The format of our PDB-style files is described here.)

Timeline for d3hn3d1: