Lineage for d3hl5b_ (3hl5 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038187Protein automated matches [190700] (1 species)
    not a true protein
  7. 3038188Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries)
  8. 3038194Domain d3hl5b_: 3hl5 B: [211120]
    Other proteins in same PDB: d3hl5a2
    automated match to d3cm2a_
    complexed with 9jz, zn

Details for d3hl5b_

PDB Entry: 3hl5 (more details), 1.8 Å

PDB Description: Crystal structure of XIAP BIR3 with CS3
PDB Compounds: (B:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d3hl5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hl5b_ g.52.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsed
pweqhakwypgckylleqkgqeyinnihlt

SCOPe Domain Coordinates for d3hl5b_:

Click to download the PDB-style file with coordinates for d3hl5b_.
(The format of our PDB-style files is described here.)

Timeline for d3hl5b_: