Class g: Small proteins [56992] (100 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
Protein automated matches [190700] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries) |
Domain d3hl5b_: 3hl5 B: [211120] Other proteins in same PDB: d3hl5a2 automated match to d3cm2a_ complexed with 9jz, zn |
PDB Entry: 3hl5 (more details), 1.8 Å
SCOPe Domain Sequences for d3hl5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hl5b_ g.52.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsed pweqhakwypgckylleqkgqeyinnihlt
Timeline for d3hl5b_: