Lineage for d3hl5a1 (3hl5 A:256-346)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589070Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2589071Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2589072Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2589206Protein automated matches [190700] (1 species)
    not a true protein
  7. 2589207Species Human (Homo sapiens) [TaxId:9606] [187840] (46 PDB entries)
  8. 2589212Domain d3hl5a1: 3hl5 A:256-346 [211119]
    Other proteins in same PDB: d3hl5a2
    automated match to d3cm2a_
    complexed with 9jz, zn

Details for d3hl5a1

PDB Entry: 3hl5 (more details), 1.8 Å

PDB Description: Crystal structure of XIAP BIR3 with CS3
PDB Compounds: (A:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d3hl5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hl5a1 g.52.1.1 (A:256-346) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsed
pweqhakwypgckylleqkgqeyinnihlth

SCOPe Domain Coordinates for d3hl5a1:

Click to download the PDB-style file with coordinates for d3hl5a1.
(The format of our PDB-style files is described here.)

Timeline for d3hl5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hl5a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3hl5b_