SCOPe 2.03: Domain d3hl5b_: 3hl5 B:

Lineage for d3hl5b_ (3hl5 B:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (21 PDB entries)

8. Domain d3hl5b_: 3hl5 B: [211120]
   automated match to d3cm2a_
   complexed with 9jz, zn

Details for d3hl5b_

PDB Entry: 3hl5, 1.8 Å

PDB Description: Crystal structure of XIAP BIR3 with CS3

PDB Compounds: (B:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d3hl5b_:

Sequence; same for both SEQRES and ATOM records:

>d3hl5b_ g.52.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsed
pweqhakwypgckylleqkgqeyinnihlt

Timeline for d3hl5b_:

• d3hl5b_ is new in SCOPe 2.03-stable
  
• d3hl5b_ appears in SCOPe 2.04
  
• d3hl5b_ appears in the current release, SCOPe 2.08