PDB entry 3hl5

View 3hl5 on RCSB PDB site
Description: Crystal structure of XIAP BIR3 with CS3
Class: ligase
Keywords: BIR, IAP, apoptosis, small molecule drug discovery, structure-based drug design, Ligase, Metal-binding, Phosphoprotein, Protease inhibitor, Thiol protease inhibitor, Ubl conjugation pathway, Zinc-finger
Deposited on 2009-05-26, released 2009-06-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: baculoviral iap repeat-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: API3, BIRC4, IAP3, XIAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98170 (4-94)
      • expression tag (1-3)
    Domains in SCOPe 2.08: d3hl5a1, d3hl5a2
  • Chain 'B':
    Compound: baculoviral iap repeat-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: API3, BIRC4, IAP3, XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hl5b_
  • Heterogens: ZN, 9JZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hl5A (A:)
    gshmlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwk
    psedpweqhakwypgckylleqkgqeyinnihlth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hl5A (A:)
    shmlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkp
    sedpweqhakwypgckylleqkgqeyinnihlth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hl5B (B:)
    gshmlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwk
    psedpweqhakwypgckylleqkgqeyinnihlth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hl5B (B:)
    lprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsed
    pweqhakwypgckylleqkgqeyinnihlt